PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC14186_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family S1Fa-like
Protein Properties Length: 76aa    MW: 8229.98 Da    PI: 10.796
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC14186_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA138.71.3e-43876270
         S1FA  2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                 ++a++eakGlnPGlivllv+gg+l+vflv+ny++yvyaqknlPPrkkkPvskkklkreklkqGv+vPGe
  RrC14186_p2  8 GKAAAEAKGLNPGLIVLLVIGGPLVVFLVANYVMYVYAQKNLPPRKKKPVSKKKLKREKLKQGVPVPGE 76
                 57899***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046893.1E-381276IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MDKEGFAGKA AAEAKGLNPG LIVLLVIGGP LVVFLVANYV MYVYAQKNLP PRKKKPVSKK  60
KLKREKLKQG VPVPGE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892693e-80AC189269.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB023B16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013600217.18e-24PREDICTED: DNA-binding protein S1FA1
RefseqXP_013730236.18e-24PREDICTED: DNA-binding protein S1FA1-like
SwissprotQ423372e-25S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLA0A078J2Z09e-24A0A078J2Z0_BRANA; BnaCnng30990D protein
STRINGAT2G37120.15e-23(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769